PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Ctg13801653g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 434aa    MW: 48147 Da    PI: 6.1197
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Ctg13801653g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box171.2e-05245340
                     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                                 e+ C+ ++ +++  +C+++   lC  C +  H        Ht++
  Peinf101Ctg13801653g00004.1  2 EPLCEVCGIERAVMYCKSDAARLCLPCDERVHLAnclsrkHTRS 45
                                 689**************************999545666677765 PP

2CCT61.92.1e-21379422144
                          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                  R++a++RYkeK+ktR F+K+irY+sRK++A++R RvKGrFvk+ 
  Peinf101Ctg13801653g00004.1 379 RNEAKKRYKEKKKTRTFSKQIRYASRKVRADTRRRVKGRFVKAG 422
                                  99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.4E-11147IPR000315B-box-type zinc finger
PROSITE profilePS501199.57147IPR000315B-box-type zinc finger
CDDcd000211.44E-6347No hitNo description
PROSITE profilePS501198.7744388IPR000315B-box-type zinc finger
PROSITE profilePS5101714.694379421IPR010402CCT domain
PfamPF062034.3E-16379421IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MEPLCEVCGI ERAVMYCKSD AARLCLPCDE RVHLANCLSR KHTRSLICDN CSSEPAIVRC  60
MMNEMCLCEG CDSIRNDCIV SGHQHKKLES YSGCPSRAEY TKFISAAFEM LNDNNVPNPS  120
NSYYTPSSLN TFNENNCSTA YLEPREHEGS LIASRLNELA SCIKFEPRTV PSPAIPSNPT  180
YNIDQAPFFS VESSLPKQHC ANIKDIGVLG GDDLSNGFDL DELRFSSDCS YKIFGSAQQS  240
HSGYQSEDRG LDCLVMEKKL SVTGSNSHVG TALEALSSGQ KECIEFQSSQ KAAAASSESL  300
LQTVSGTANC MLMNPNCNRD ISLAFPPPVP VNSRSLSLSN ITGESSETTD YQDCGLSPAF  360
LTGESPWDWN LETDILRARN EAKKRYKEKK KTRTFSKQIR YASRKVRADT RRRVKGRFVK  420
AGEAYDYDPL ETRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327012e-32AC232701.2 Solanum lycopersicum chromosome 05 clone C05HBa0031K11, complete sequence.
GenBankHG9755172e-32HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597063.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like
TrEMBLA0A068UW261e-152A0A068UW26_COFCA; Uncharacterized protein
STRINGSolyc05g046040.1.11e-133(Solanum lycopersicum)
STRINGGLYMA12G32221.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42311726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-63B-box type zinc finger protein with CCT domain